DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT71C5

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_172204.1 Gene:UGT71C5 / 837235 AraportID:AT1G07240 Length:480 Species:Arabidopsis thaliana


Alignment Length:369 Identity:76/369 - (20%)
Similarity:120/369 - (32%) Gaps:124/369 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ISDSVEKGKGMSFRQRLAGYSSSFF-FGIFDFVTQRRSKRLYKELFGDDPNMPEYSELVKNTSLI 253
            :|.|...|.|.|   .:||....|| .|:.|              .|.:.|:|.|..:..|...:
plant   108 VSSSSSSGGGSS---HVAGLILDFFCVGLID--------------IGREVNLPSYIFMTSNFGFL 155

  Fly   254 FFASHAPSEGPIRPN-------------------VPAAI----------------------EIGG 277
            ....:.|....:.|:                   |||.:                      |..|
plant   156 GVLQYLPERQRLTPSEFDESSGEEELHIPAFVNRVPAKVLPPGVFDKLSYGSLVKIGERLHEAKG 220

  Fly   278 I-----------------QVKDTPDPLP--------------------QNMAEFLGNATDGAIL- 304
            |                 |.:|.|...|                    :.|.::|....|.::| 
plant   221 ILVNSFTQVEPYAAEHFSQGRDYPHVYPVGPVLNLTGRTNPGLASAQYKEMMKWLDEQPDSSVLF 285

  Fly   305 LSLGSNVKGSHINPDTVVKMFNVLSKLKQRVIWKWED----------------LEKTPGKSDNIF 353
            |..||  .|....|. :.::.:.|..:..|.||....                :::|.|:.   .
plant   286 LCFGS--MGVFPAPQ-ITEIAHALELIGCRFIWAIRTNMAGDGDPQEPLPEGFVDRTMGRG---I 344

  Fly   354 YSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMVKQGFGLTQSL 418
            ...|.||.|||||.....|::|.|...:.|:.::|.|:.:.|::.:|..||..|||: .||...:
plant   345 VCSWAPQVDILAHKATGGFVSHCGWNSVQESLWYGVPIATWPMYAEQQLNAFEMVKE-LGLAVEI 408

  Fly   419 LSLEEQPFKEAILEILSNPQYFDKVASFSSLYRDRPMSARESVI 462
            ............|||:|    .|::|:......|.....|:.||
plant   409 RLDYVADGDRVTLEIVS----ADEIATAVRSLMDSDNPVRKKVI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 76/369 (21%)
UGT71C5NP_172204.1 PLN02167 1..480 CDD:215112 76/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.