DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT72E2

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_201470.1 Gene:UGT72E2 / 836802 AraportID:AT5G66690 Length:481 Species:Arabidopsis thaliana


Alignment Length:484 Identity:95/484 - (19%)
Similarity:154/484 - (31%) Gaps:193/484 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HGANILGVFTSLSPSHLIIQMSTAKVL-AERGHNVTVITVLKPVVNHKNITVIMVPLTKEESQQM 85
            |.|    :|:|....|:|..:...|.| |..|.:|||. ||:                       
plant     7 HAA----MFSSPGMGHVIPVIELGKRLSANNGFHVTVF-VLE----------------------- 43

  Fly    86 SDTIGAMSKTDNSNMI----LSMLRMMGQMEFMFDKMAGALKDDRVRDLYLNRDNKFDLVLSGYF 146
            :|...|.||..||..:    |....:.|.::          .||.|                   
plant    44 TDAASAQSKFLNSTGVDIVKLPSPDIYGLVD----------PDDHV------------------- 79

  Fly   147 MNVYQLGFAKKVKAPVI--VVATM--PPNQLLNPLIG----------NPLEIAYVPSISDSVEKG 197
              |.::|...:...|.:  .:|.|  .|..|:..|.|          |.|...::|:        
plant    80 --VTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLFGTDALCLAKEFNMLSYVFIPT-------- 134

  Fly   198 KGMSFRQRLAGYSSSFFFGIFD------FVTQRRSKRL---YKELFGDD------PNMPEYSELV 247
                 ..|..|.  |.::...|      ...||....:   ....|.|.      |:.|.|.:.|
plant   135 -----NARFLGV--SIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLVPDEPVYRDFV 192

  Fly   248 K----------------------------NTSLIFFASHAP--SEGPI-RPNVPAAIEIGGIQVK 281
            :                            |..|:...:..|  ..||: ||          ||..
plant   193 RHGLAYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCRP----------IQSS 247

  Fly   282 DTPDPLPQNMAEFLGNATDGAIL-LSLGSNVKGSHINPDTVVKMFNVLSKLKQRVIWKWEDLEKT 345
            :|..|    :.::|....:.::| :|.||   |..::...:.::...|.:.:||.:|    :.:.
plant   248 ETDHP----VLDWLNEQPNESVLYISFGS---GGCLSAKQLTELAWGLEQSQQRFVW----VVRP 301

  Fly   346 P---------------GKSDNI-------FYSK----------WLPQDDILAHPNIKLFINHAGK 378
            |               |..||.       |.|:          |.||.:||:|..:..|:.|.|.
plant   302 PVDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSHRAVGGFLTHCGW 366

  Fly   379 GGITEAQYHGKPMLSLPVFGDQPGNADVM 407
            ....|:...|.||::.|:|.:|..||.::
plant   367 SSTLESVVGGVPMIAWPLFAEQNMNAALL 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 95/484 (20%)
UGT72E2NP_201470.1 PLN02992 1..481 CDD:178572 95/484 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.