DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and AT5G17040

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:386 Identity:75/386 - (19%)
Similarity:130/386 - (33%) Gaps:121/386 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 FMNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSISDSVEKGKGMS--------- 201
            |:|..|..|:       ::.:.:|||             ..|..:||.|.:|..:|         
plant    38 FLNTSQSNFS-------LLSSDLPPN-------------IRVHDVSDGVPEGYVLSRNPQEAVEL 82

  Fly   202 --------FRQRLA------------GYSSSFFFGIFDFV---------------------TQRR 225
                    ||:.||            ..:.:|.:...|..                     ||..
plant    83 FLEAAPEIFRRELAVAETEVGRKVTCMLTDAFIWFAGDMAAEMKVSWVAFWTSGTRSLLISTQIS 147

  Fly   226 SKR--LYKELFGDDPNM--------PE----------YSELVKNTSL-------IFFASHAPSEG 263
            |::  |.||..|....|        ||          :|:::....|       ::..|....:.
plant   148 SEKQSLSKETLGCISGMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATTVYMNSFEELDP 212

  Fly   264 PIRPNV-----------PAAIEIGGIQVKDTPDPLPQN-MAEFLGNATDGAILLSLGSNVKGSHI 316
            .:..|:           |.|:.....| ::||...|.. :|.....:|...:.::.|..:...  
plant   213 TLTDNLRLKFKRYLSIGPLALLFSTSQ-RETPLHDPHGCLAWIKKRSTASVVYIAFGRVMTPP-- 274

  Fly   317 NPDTVVKMFNVLSKLKQRVIWKWED-----LEK--TPGKSDNIFYSKWLPQDDILAHPNIKLFIN 374
             |..:|.:...|...|...:|..::     |.|  ..|..:......|.||.::|.|..:.:|::
plant   275 -PGELVVVAQGLESSKVPFVWSLQEKNMVHLPKGFLDGTREQGMVVPWAPQVELLNHEAMGVFVS 338

  Fly   375 HAGKGGITEAQYHGKPMLSLPVFGDQPGNA-DVMVKQGFGLTQSLLSLEEQPFKEAILEIL 434
            |.|...:.|:...|.||:..|:|||...|| .|......|:|.|.....:..|:|::..:|
plant   339 HGGWNSVLESVSAGVPMICRPIFGDHALNARSVEAVWEIGMTISSGVFTKDGFEESLDRVL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 75/386 (19%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 75/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.