DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and AT5G12890

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_196793.1 Gene:AT5G12890 / 831129 AraportID:AT5G12890 Length:488 Species:Arabidopsis thaliana


Alignment Length:465 Identity:92/465 - (19%)
Similarity:155/465 - (33%) Gaps:152/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VFTSLSPSHLI----IQMSTAKVLAERGHNVTVITVLKPVVN----------HKNITVIMVPLTK 79
            :|..:...|:|    :.:...|::.....|.|.|:::....|          ..:|::|.:|...
plant    13 MFPFMGQGHIIPFVALALRLEKIMIMNRANKTTISMINTPSNIPKIRSNLPPESSISLIELPFNS 77

  Fly    80 EESQQMSDTIGAMSKTDNSNMILSMLRMMGQMEFMF-DKMAGALKDDRVRDLYLNRDNKFDLVLS 143
            .:.....|  |....:...::::|:|.....:...| |.|...||::....:         :|:.
plant    78 SDHGLPHD--GENFDSLPYSLVISLLEASRSLREPFRDFMTKILKEEGQSSV---------IVIG 131

  Fly   144 GYFMNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSISDSVEKGKGMSFRQRLAG 208
            .:|     ||:..||...|.|.:.:                                        
plant   132 DFF-----LGWIGKVCKEVGVYSVI---------------------------------------- 151

  Fly   209 YSSSFFFGIFDFVTQRRSKRL---YKELFGDD---PNMPEYSELVKNTSLIFFASHAPSEG---- 263
            :|:|..||:..:    ||..|   :||...|.   .:.||..|:.| |.|..|...|....    
plant   152 FSASGAFGLGCY----RSIWLNLPHKETKQDQFLLDDFPEAGEIEK-TQLNSFMLEADGTDDWSV 211

  Fly   264 ---PIRP----------NVPAAIEIGGIQ--------------------------------VKDT 283
               .|.|          |..|.|:..|:.                                ||..
plant   212 FMKKIIPGWSDFDGFLFNTVAEIDQMGLSYFRRITGVPVWPVGPVLKSPDKKVGSRSTEEAVKSW 276

  Fly   284 PDPLPQNMAEFLGNATDGAIL----LSLGSNVKGSHINPDTVVK---------MFNVLSKLKQRV 335
            .|..|.:...::...:..:||    |.|...::.|..|...||:         .|:|...|.   
plant   277 LDSKPDHSVVYVCFGSMNSILQTHMLELAMALESSEKNFIWVVRPPIGVEVKSEFDVKGYLP--- 338

  Fly   336 IWKWEDLEKTPGKSD-NIFYSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGD 399
                |..|:...:|: .:...||.||.|||:|....:|::|.|...|.|:..||.|:|..|:..:
plant   339 ----EGFEERITRSERGLLVKKWAPQVDILSHKATCVFLSHCGWNSILESLSHGVPLLGWPMAAE 399

  Fly   400 QPGNADVMVK 409
            |..|:.:|.|
plant   400 QFFNSILMEK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 92/465 (20%)
AT5G12890NP_196793.1 Glycosyltransferase_GTB-type 2..478 CDD:415824 92/465 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.