DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT76C1

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:439 Identity:90/439 - (20%)
Similarity:139/439 - (31%) Gaps:154/439 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MSTAKVLAERGHNVTVITV---LKPVVNHKNITVIMVPLTKEESQQMSDTIGAMSKTDNSNMILS 103
            :..||:|..||.::|:|..   .....:|...|.:.:.....|||           |.:.:::|.
plant    24 LQLAKILYSRGFSITIIHTRFNAPKSSDHPLFTFLQIRDGLSESQ-----------TQSRDLLLQ 77

  Fly   104 MLRMMGQMEFMF-DKMAGALKDDRVRDLYLNRDNKFDLVL--SGYFMNVYQLGFAKKVKAPVIVV 165
            :..:....:..| :.:|..:|......   ..|.|...|:  ||:   |:....|:....|..| 
plant    78 LTLLNNNCQIPFRECLAKLIKPSSDSG---TEDRKISCVIDDSGW---VFTQSVAESFNLPRFV- 135

  Fly   166 ATMPPNQLLNPLIGNPLEIAYVPSISDSVEKGKGMSFRQRLAGYSSSFFFGIFDFVTQRRSKRLY 230
                                                    |..|..|||.|.| .|.|.|     
plant   136 ----------------------------------------LCAYKFSFFLGHF-LVPQIR----- 154

  Fly   231 KELFGDDPN------MPEYSEL-------VKNTS----------LIFFASHAPSEG--------- 263
            :|.|...|:      :||:..|       :..||          |....:..|:.|         
plant   155 REGFLPVPDSEADDLVPEFPPLRKKDLSRIMGTSAQSKPLDAYLLKILDATKPASGIIVMSCKEL 219

  Fly   264 --------------PIRPNVPAAIEIGGIQVKDTP-------DPLPQNMAEFLG-NATDGAILLS 306
                          ||.|       ||...:.|.|       :| .|:...:|. ..|...:.:|
plant   220 DHDSLAESNKVFSIPIFP-------IGPFHIHDVPASSSSLLEP-DQSCIPWLDMRETRSVVYVS 276

  Fly   307 LGSNVKGSHINPDTVVKMFNVLSKLKQRVIW----------KWED------LEKTPGKSDNIFYS 355
            |||.   :.:|....:::...|....|..:|          .|.:      :|...||...:   
plant   277 LGSI---ASLNESDFLEIACGLRNTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGKIV--- 335

  Fly   356 KWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNA 404
            :|.||.|:|||.....|:.|.|.....|:...|.||:.||...||..||
plant   336 RWAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 90/439 (21%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 90/439 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.