DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and AT4G36770

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:434 Identity:85/434 - (19%)
Similarity:151/434 - (34%) Gaps:138/434 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GHNVTVITVLKPVVNHKNITVIMVPLTKEESQQMSDTIGAMSKTDNSNMILSM--LRMMGQ---- 110
            ||.|.::.:.|.::||.....:.|.|..::..:....||.....::...::..  |.:.||    
plant    14 GHAVPILELGKHLLNHHGFDRVTVFLVTDDVSRSKSLIGKTLMEEDPKFVIRFIPLDVSGQDLSG 78

  Fly   111 --MEFMFDKMAGALKDDRVRDLYLNRDNKFDLVLSGYFMNVYQLGFAKKVKAPVIVVATMPPNQL 173
              :..:.:.|..||.:                                 :|:.|:.:...|...:
plant    79 SLLTKLAEMMRKALPE---------------------------------IKSSVMELEPRPRVFV 110

  Fly   174 LNPLIGNPLEIAYVPSISDSVEKGKGMSFRQRLAGYSSSFFFGIFDFVTQRRSKRLYKELF---- 234
            ::.|....||:|          |..|: .|:.:...:|::|.....::.....:.|||:|.    
plant   111 VDLLGTEALEVA----------KELGI-MRKHVLVTTSAWFLAFTVYMASLDKQELYKQLSSIGA 164

  Fly   235 -------------GDDPN--MPEYSE-------------LVKNT--SL--IFFASHAPSE----- 262
                         ..||.  :.|.:|             :..||  ||  :...|....|     
plant   165 LLIPGCSPVKFERAQDPRKYIRELAESQRIGDEVITADGVFVNTWHSLEQVTIGSFLDPENLGRV 229

  Fly   263 ---------GP-IRPNVPAAIEIGGIQ--VKDTPDPLPQNMAEFLGNATDGAIL------LSLGS 309
                     || :||..|      |::  |.|..|..|:....::...:.||:.      |:.|.
plant   230 MRGVPVYPVGPLVRPAEP------GLKHGVLDWLDLQPKESVVYVSFGSGGALTFEQTNELAYGL 288

  Fly   310 NVKGSH----INP----DTVVKMFNVLSKLKQRVIWKWEDLEKTPG------KSDNIFYSKWLPQ 360
            .:.|..    :.|    |....||:   |.|...    |.|:..|.      |...:....|.||
plant   289 ELTGHRFVWVVRPPAEDDPSASMFD---KTKNET----EPLDFLPNGFLDRTKDIGLVVRTWAPQ 346

  Fly   361 DDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNA 404
            ::||||.:...|:.|.|...:.|:..:|.||::.|::.:|..||
plant   347 EEILAHKSTGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 85/434 (20%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 85/434 (20%)
YjiC 6..451 CDD:224732 85/434 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.