DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT72E1

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_566938.1 Gene:UGT72E1 / 824238 AraportID:AT3G50740 Length:487 Species:Arabidopsis thaliana


Alignment Length:413 Identity:87/413 - (21%)
Similarity:129/413 - (31%) Gaps:178/413 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 GYFMNVYQLGFAKKV------KAPVIVV---ATMPPNQLLN---------PLIGNPLEIAYVPSI 190
            |:.:.|.:||  |::      ...:.|:   |....:|.||         .::|.|     .|.|
plant    17 GHIIPVIELG--KRLAGSHGFDVTIFVLETDAASAQSQFLNSPGCDAALVDIVGLP-----TPDI 74

  Fly   191 SDSVEKGKGMSFRQRLAGYSSSFFFGIFDFVTQR------RSK---------RLYKELFGDD--P 238
            |..|:               .|.||||...|..|      |||         .|..:|||.|  |
plant    75 SGLVD---------------PSAFFGIKLLVMMRETIPTIRSKIEEMQHKPTALIVDLFGLDAIP 124

  Fly   239 NMPEYSELVKNTSLIFFASHA-----------------------------PSEGPIR-------- 266
            ...|::.|    :.||.||:|                             |...|:|        
plant   125 LGGEFNML----TYIFIASNARFLAVALFFPTLDKDMEEEHIIKKQPMVMPGCEPVRFEDTLETF 185

  Fly   267 --PN-------VP------------------------------------AAIEIGGIQVKDTP-D 285
              ||       ||                                    |.:.:..|.....| |
plant   186 LDPNSQLYREFVPFGSVFPTCDGIIVNTWDDMEPKTLKSLQDPKLLGRIAGVPVYPIGPLSRPVD 250

  Fly   286 PLPQN--MAEFLGNATDGAIL-LSLGSNVKGSHINPDTVVKMFNVLSKLKQRVIWKWED------ 341
            |...|  :.::|....|.::| :|.||   |..::...:.::...|...:||.:|....      
plant   251 PSKTNHPVLDWLNKQPDESVLYISFGS---GGSLSAKQLTELAWGLEMSQQRFVWVVRPPVDGSA 312

  Fly   342 ----LEKTPGK------------------SDNIFYSKWLPQDDILAHPNIKLFINHAGKGGITEA 384
                |....||                  ......|.|.||.:||||..:..|:.|.|...|.|:
plant   313 CSAYLSANSGKIRDGTPDYLPEGFVSRTHERGFMVSSWAPQAEILAHQAVGGFLTHCGWNSILES 377

  Fly   385 QYHGKPMLSLPVFGDQPGNADVM 407
            ...|.||::.|:|.:|..||.::
plant   378 VVGGVPMIAWPLFAEQMMNATLL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 87/413 (21%)
UGT72E1NP_566938.1 PLN02992 1..487 CDD:178572 87/413 (21%)
YjiC 5..479 CDD:224732 87/413 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.