DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT84A2

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_188793.1 Gene:UGT84A2 / 821710 AraportID:AT3G21560 Length:496 Species:Arabidopsis thaliana


Alignment Length:520 Identity:90/520 - (17%)
Similarity:176/520 - (33%) Gaps:183/520 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HLIIQMSTAKVLAERGHNVTVITV----LKPVVNHKNITVIMVPLTK------------EESQQM 85
            |:...:...|:||.:|..:|.:|.    .|..:::|....::.|:.|            .|..:.
plant    23 HVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRVLKPVGKGYLRYDFFDDGLPEDDEA 87

  Fly    86 SDTIGAMSKTDNSNMILSMLRMMGQMEFMFDKMAGALKDDRVRDLYLNRDNKFDLVLSGYFMNVY 150
            |.|        |..::...|.::|:.|              :::|...                 
plant    88 SRT--------NLTILRPHLELVGKRE--------------IKNLVKR----------------- 113

  Fly   151 QLGFAKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSISDSVEKGKGMSFRQRLAGYSSSFFF 215
               :.:..|.||..            ||.||. :::|..:::.::....:.:.|..|..::.:::
plant   114 ---YKEVTKQPVTC------------LINNPF-VSWVCDVAEDLQIPCAVLWVQSCACLAAYYYY 162

  Fly   216 --GIFDFVTQRRSKRLYKELFGDDPNMPEYSELVKNTSLIFFASHAPSEGPIRPNVP--AAIEIG 276
              .:.||.|:..               ||....:....|:   .|......|.|:.|  |..|:.
plant   163 HHNLVDFPTKTE---------------PEIDVQISGMPLL---KHDEIPSFIHPSSPHSALREVI 209

  Fly   277 GIQVK----------DTPDPLPQNMAEFLGNATDGAILLSLGSNVKGSHINPDTVVKM------- 324
            ..|:|          ||.:.|.:::.:.:...:...::..||...|.:......|||:       
plant   210 IDQIKRLHKTFSIFIDTFNSLEKDIIDHMSTLSLPGVIRPLGPLYKMAKTVAYDVVKVNISEPTD 274

  Fly   325 ------------------FNVLSKLKQRVI---------------W--KWEDL----------EK 344
                              |..::.|||..|               |  :.::|          |:
plant   275 PCMEWLDSQPVSSVVYISFGTVAYLKQEQIDEIAYGVLNADVTFLWVIRQQELGFNKEKHVLPEE 339

  Fly   345 TPGKSDNIFYSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMV- 408
            ..||...:   :|..|:.:|:||::..|:.|.|.....||...|.|.:..|.:|||..:|..|: 
plant   340 VKGKGKIV---EWCSQEKVLSHPSVACFVTHCGWNSTMEAVSSGVPTVCFPQWGDQVTDAVYMID 401

  Fly   409 --KQGFGLT-----QSLLSLEEQPFKEAILEILSNPQYFDKVASFSSLYRDRPMSARESVIYWTE 466
              |.|..|:     :.|:..||  ..|.:.|:...               ::.:..:::.:.|.|
plant   402 VWKTGVRLSRGEAEERLVPREE--VAERLREVTKG---------------EKAIELKKNALKWKE 449

  Fly   467  466
            plant   450  449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 90/520 (17%)
UGT84A2NP_188793.1 Glycosyltransferase_GTB-type 1..485 CDD:415824 90/520 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.