DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT73C6

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_181217.1 Gene:UGT73C6 / 818251 AraportID:AT2G36790 Length:495 Species:Arabidopsis thaliana


Alignment Length:487 Identity:104/487 - (21%)
Similarity:183/487 - (37%) Gaps:137/487 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VFTSLSPSHLIIQMSTAKVLAERGHNVTVITVLKPVVNHKN-----------ITVIMVPLTKEES 82
            :|..::..|:|..:..|::||:||..:|::|........||           |.::.|....:|:
plant    16 LFPFMAQGHMIPMVDIARLLAQRGVLITIVTTPHNAARFKNVLNRAIESGLPINLVQVKFPYQEA 80

  Fly    83 QQMSDTIGAMSKTDNSNMILSMLRMMGQMEFMFDKMAGALKDDRVRDLYLNRDNKFDLVLSGYFM 147
                   |.....:|.:::.:|.::..     |.|....||:. |::|......:...::|...:
plant    81 -------GLQEGQENMDLLTTMEQITS-----FFKAVNLLKEP-VQNLIEEMSPRPSCLISDMCL 132

  Fly   148 NVYQLGFAKKVKAPVI---------------------------------VVATMPPN-QLLNPLI 178
            : |....|||.|.|.|                                 :|...|.. :...|.:
plant   133 S-YTSEIAKKFKIPKILFHGMGCFCLLCVNVLRKNREILDNLKSDKEYFIVPYFPDRVEFTRPQV 196

  Fly   179 GNPLEIAYVPS-----ISDSVEKGK---GM---SFRQRLAGYSSSFFFGIFDFVTQRRSK----- 227
              |:| .|||:     :.|.||..|   |:   ||::....|:.       ||...|..|     
plant   197 --PVE-TYVPAGWKEILEDMVEADKTSYGVIVNSFQELEPAYAK-------DFKEARSGKAWTIG 251

  Fly   228 --RLYKELFGDDPNMPEYSELVKNTSLIFFASHAPSEGPIRPNVPAAIEIGGIQVKDTPDPLPQN 290
              .|..::..|.......|::.::..|.:..|..|  |.:     ..:.:|.|    ...||.| 
plant   252 PVSLCNKVGVDKAERGNKSDIDQDECLEWLDSKEP--GSV-----LYVCLGSI----CNLPLSQ- 304

  Fly   291 MAEFLGNATDGAILLSLGSNVKGSHINPDTVVKMFNVLSKLKQRVIW----KWEDLEKTPGKSDN 351
                         ||.||..::.|......|::.:   .|.|:.|.|    .:||..:..|    
plant   305 -------------LLELGLGLEESQRPFIWVIRGW---EKYKELVEWFSESGFEDRIQDRG---- 349

  Fly   352 IFYSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMV---KQG-- 411
            :....|.||..||:||::..|:.|.|.....|....|.|||:.|:|.||..|..::|   |.|  
plant   350 LLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPMLTWPLFADQFCNEKLVVQILKVGVS 414

  Fly   412 --------FGLTQSL-LSLEEQPFKEAILEIL 434
                    :|..:.: :.::::..|:|:.|::
plant   415 AEVKEVMKWGEEEKIGVLVDKEGVKKAVEELM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 104/487 (21%)
UGT73C6NP_181217.1 Glycosyltransferase_GTB-type 12..494 CDD:385653 104/487 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.