DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and AT2G18560

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:381 Identity:74/381 - (19%)
Similarity:145/381 - (38%) Gaps:91/381 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 KVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPS------------ISDSVEKGKGMSFRQ--RLA 207
            |.|..|::|.......|....:|...:..|:||            :.|.|.:|:.:..::  ::.
plant    16 KQKPTVMIVDFFGTALLSITDVGVTSKYVYIPSHAWFLALIVYLPVLDKVMEGEYVDIKEPMKIP 80

  Fly   208 GYSSSFFFGIFDFVTQRRSKRLYKELFGDDPNMPEYSELVKNTSLIFFASHAPSEGPIRPNVPAA 272
            |........:.|.:.. ||.:.|::.......:|....::.||           .|.::....||
plant    81 GCKPVGPKELLDTMLD-RSDQQYRDCVQIGLEIPMSDGVLVNT-----------WGELQGKTLAA 133

  Fly   273 IE---------------IGGIQVKDTPDPLPQNMAEFLGNATDGAIL-LSLGSNVKGSHINPDTV 321
            :.               ||.|...:.....|.:..|:|....:.::: :.|||   |..::.:..
plant   134 LREDIDLNRVIKVPVYPIGPIVRTNVLIEKPNSTFEWLDKQEERSVVYVCLGS---GGTLSFEQT 195

  Fly   322 VKMFNVLSKLKQRVIW-------------KWED----------LEKTPGKSDNIFYSKWLPQDDI 363
            :::...|....|..:|             |.:|          |::|.|.  .:..::|.||.:|
plant   196 MELAWGLELSCQSFLWVLRKPPSYLGASSKDDDQVSDGLPEGFLDRTRGV--GLVVTQWAPQVEI 258

  Fly   364 LAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMVKQ-GFGLTQSLLSLEEQPFK 427
            |:|.:|..|::|.|...:.|:...|.|:::.|::.:|..||.::.:: |..:..|     |.|.|
plant   259 LSHRSIGGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNATLLTEEIGMAIRTS-----ELPSK 318

  Fly   428 EAILEILSNPQYFDKVASF-SSLYRDRPMSAR------ESVIYWTEYVIRHHGAAH 476
            :.|..        ::|||. ..:..:.....|      |.|...:|....|.|::|
plant   319 KVISR--------EEVASLVKKIVAEEDKEGRKIKTKAEEVRVSSERAWTHGGSSH 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 74/381 (19%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 74/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.