DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT2B17

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:543 Identity:138/543 - (25%)
Similarity:251/543 - (46%) Gaps:97/543 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SHLIIQMSTAKVLAERGHNVTVITVLKPVVNHKNITVIMVPLTKEESQQMSDTIGAMSKTD---- 96
            ||.|...:..:.|.:|||.|.|:|         :...|:|..:|..:.::.....:::|.|    
Human    34 SHWINMKTILEELVQRGHEVIVLT---------SSASILVNASKSSAIKLEVYPTSLTKNDLEDF 89

  Fly    97 ------------NSNMILSMLRMMGQMEFMFDKMAGALKDDRVRDLYLNR---DNKFDLVLSGYF 146
                        :.|...|....:.::.:.:......|.:|.|.:..|.|   ::|||::|:.  
Human    90 FMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLAD-- 152

  Fly   147 MNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSISDSVEKGKG------------ 199
                               |..|..:||..|:..|...:...|:..:|||..|            
Human   153 -------------------AVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVV 198

  Fly   200 -------MSFRQRLAGYSSSFFFGIFDFVTQ----RRSKRLYKELFGDDPNMPEYSELVKNTSLI 253
                   |.|.:|:   .:..:...|||..|    ::..:.|.|:.|....:   .|.:....:.
Human   199 MSELSDQMIFMERI---KNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTL---FETMGKAEMW 257

  Fly   254 FFASHAPSEGPIRPNVPAAIEIGGIQVKDTPDPLPQNMAEFL-GNATDGAILLSLGSNVKGSHIN 317
            ...::...|.| ||.:|....:||:..|.. .|||:.|.||: .:..:|.::.||||.:  |:::
Human   258 LIRTYWDFEFP-RPFLPNVDFVGGLHCKPA-KPLPKEMEEFVQSSGENGIVVFSLGSMI--SNMS 318

  Fly   318 PDTVVKMFNVLSKLKQRVIWKWEDLEKTPGKSDNIFYS-----KWLPQDDILAHPNIKLFINHAG 377
            .::...:.:.|:::.|:|:|:::      ||..|...|     |||||:|:|.||..|.||.|.|
Human   319 EESANMIASALAQIPQKVLWRFD------GKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGG 377

  Fly   378 KGGITEAQYHGKPMLSLPVFGDQPGNADVMVKQGFGLTQSLLSLEEQPFKEAILEILSNPQYFDK 442
            ..||.||.|||.||:.:|:|.||..|...|..:|..|:..:.::..:....|:..::::|.|.:.
Human   378 TNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKEN 442

  Fly   443 VASFSSLYRDRPMSARESVIYWTEYVIRHHGAAHLQSPLVHMSFIAANNIDIYA-LIAVVLVILV 506
            :...|.::.|:|:...:..::|.|:|:||.||.||:....::::|..:::|:.| |:|.|..::.
Human   443 IMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIF 507

  Fly   507 LLLKLLLQFIYRKIFAKPKKEKK 529
            ::.|..| |.:||: ||..|:||
Human   508 MITKCCL-FCFRKL-AKTGKKKK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 123/501 (25%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 131/530 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.