DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT2B10

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001066.1 Gene:UGT2B10 / 7365 HGNCID:12544 Length:528 Species:Homo sapiens


Alignment Length:529 Identity:135/529 - (25%)
Similarity:248/529 - (46%) Gaps:72/529 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LIIQMST-AKVLAERGHNVTVITVLKPVVNHKNITVIMVPLTKEESQQMSDTI--GAMSKTDNSN 99
            |.:.|.| .|.|.:|||.|||:.        .:.:::..|   .:|..:...:  .:::||:..|
Human    34 LWMNMKTILKELVQRGHEVTVLA--------SSASILFDP---NDSSTLKLEVYPTSLTKTEFEN 87

  Fly   100 MILSMLRMMGQME---FMF-----DKMAGALKD---DRVRDLYLNR-------DNKFDLVLSGYF 146
            :|:.:::.:.:::   |..     .::..|:.|   :..:|:..|:       :::||:|.:..:
Human    88 IIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAY 152

  Fly   147 MNVYQLGFAKKVKAPVIVVATMPPNQLLNPLIGN----PLEIAYVP----SISDSVEKGKGMSFR 203
            :...:| .|:....|.:...:..|........|.    |   :|||    .:||.      |:|.
Human   153 LPCGEL-LAELFNIPFVYSHSFSPGYSFERHSGGFIFPP---SYVPVVMSKLSDQ------MTFM 207

  Fly   204 QRLAGYSSSFFFGI-FDFVTQRRSKRLYKELFGDDPNMPEYSE-----LVKNTSLIFFASHAPSE 262
            :|:.......:|.. |.....::..:.|.|:.|....:.|...     |::| |..|...|    
Human   208 ERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRN-SWNFKFPH---- 267

  Fly   263 GPIRPNVPAAIEIGGIQVKDTPDPLPQNMAEFL-GNATDGAILLSLGSNVKGSHINPDTVVKMFN 326
             |..|||..   :||:..|.. .|||:.|.||: .:..:|.::.||||.|  |::..:....:..
Human   268 -PFLPNVDF---VGGLHCKPA-KPLPKEMEEFVQSSGENGVVVFSLGSMV--SNMTEERANVIAT 325

  Fly   327 VLSKLKQRVIWKWEDLEKTPGKSDNIFYSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPM 391
            .|:|:.|:|:|:: |..|......|....||:||:|:|.||..:.||.|.|..||.||.|||.||
Human   326 ALAKIPQKVLWRF-DGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPM 389

  Fly   392 LSLPVFGDQPGNADVMVKQGFGLTQSLLSLEEQPFKEAILEILSNPQYFDKVASFSSLYRDRPMS 456
            :.:|:|.|||.|...|..:|..:.....::.......|:..::::|.|.:.:...|.:..|:|:.
Human   390 VGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVK 454

  Fly   457 ARESVIYWTEYVIRHHGAAHLQSPLVHMSFIAANNIDIYA-LIAVVLVILVLLLKLLLQFIYRKI 520
            ..:..::|.|:|:||.||.||:....::::...:::|:.. |:|.|..:|.::.|..| |.:.|.
Human   455 PLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCL-FCFWKF 518

  Fly   521 FAKPKKEKK 529
            ..|.||.|:
Human   519 ARKGKKGKR 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 122/487 (25%)
UGT2B10NP_001066.1 UDPGT 23..524 CDD:278624 132/524 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.