DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT2B4

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_066962.2 Gene:UGT2B4 / 7363 HGNCID:12553 Length:528 Species:Homo sapiens


Alignment Length:547 Identity:142/547 - (25%)
Similarity:251/547 - (45%) Gaps:54/547 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLATAICVL--GGCHGANILGVFTSLSPSHLIIQMSTAKVLAERGHNVTVITVLKPVVNHKN-- 69
            |||....|..  |.|  ..:|...|..  ||.:...:....|.:|||.|||:.....:....|  
Human     9 LLLIQLSCYFSSGSC--GKVLVWPTEF--SHWMNIKTILDELVQRGHEVTVLASSASISFDPNSP 69

  Fly    70 ----ITVIMVPLTKEESQQMSDTIGAMSKTDNSNMILSMLRMMGQMEFMFDKMAGALKDDRVRDL 130
                ..|..|.|||.|.:.:...:.........:...|....:.::.:.|:.:......|.|.:.
Human    70 STLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNK 134

  Fly   131 YLNR---DNKFDLVLSGYFMNVYQLG--FAKKVKAPVIVVATMPPNQLLNPLIGNPL-EIAYVPS 189
            .|.:   :::||:||:.   .|:..|  .|:.:|.|.:......|...:....|..| ..:|||.
Human   135 KLMKKLQESRFDVVLAD---AVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPV 196

  Fly   190 ISDSVEKGKGMSFRQRLAG----YSSSFFFGIFDFVTQRRSKRLYKELFGDDPNMPEYSE----- 245
            :..  |....|:|.:|:..    ....|:|.|||   .::..:.|.|:.|....:.|...     
Human   197 VMS--ELSDQMTFIERVKNMIYVLYFEFWFQIFD---MKKWDQFYSEVLGRPTTLSETMAKADIW 256

  Fly   246 LVKNTSLIFFASHAPSEGPIRPNVPAAIEIGGIQVKDTPDPLPQNMAEFL-GNATDGAILLSLGS 309
            |::|    ::....|.  |:.|||..   :||:..|.. .|||:.|.||: .:..:|.::.||||
Human   257 LIRN----YWDFQFPH--PLLPNVEF---VGGLHCKPA-KPLPKEMEEFVQSSGENGVVVFSLGS 311

  Fly   310 NVKGSHINPDTVVKMFNVLSKLKQRVIWKWE-DLEKTPGKSDNIFYSKWLPQDDILAHPNIKLFI 373
            .|  |:.:.:....:.:.|:|:.|:|:|::: :...|.|.:..::  ||:||:|:|.||..:.||
Human   312 MV--SNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLY--KWIPQNDLLGHPKTRAFI 372

  Fly   374 NHAGKGGITEAQYHGKPMLSLPVFGDQPGNADVMVKQGFGLTQSLLSLEEQPFKEAILEILSNPQ 438
            .|.|..||.||.|||.||:.:|:|.|||.|...|..:|..::....::.......|:..::::|.
Human   373 THGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPL 437

  Fly   439 YFDKVASFSSLYRDRPMSARESVIYWTEYVIRHHGAAHLQSPLVHMSFIAANNIDIYA-LIAVVL 502
            |.:.....|.::.|:|:...:..::|.|:|:||.||.||:.....:::...:::|:.. |:|.|.
Human   438 YKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLACVA 502

  Fly   503 VILVLLLKLLLQFIYRKIFAKPKKEKK 529
            .::.::.|.|  |...|.....||.|:
Human   503 TVIFIITKCL--FCVWKFVRTGKKGKR 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 131/505 (26%)
UGT2B4NP_066962.2 egt 8..512 CDD:223071 136/528 (26%)
UDPGT 24..524 CDD:278624 133/525 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.