DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and UGT2B28

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_444267.1 Gene:UGT2B28 / 54490 HGNCID:13479 Length:529 Species:Homo sapiens


Alignment Length:538 Identity:131/538 - (24%)
Similarity:233/538 - (43%) Gaps:87/538 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SHLIIQMSTAKVLAERGHNVTVITVLKPVVNHKNITVIMVPLTKEESQQMSDTIGAMSKTDNSNM 100
            ||.:...:..|.|.:|||.|||:.....::...|....:    |.|....|     ::||:..|:
Human    34 SHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAFTL----KLEVYPTS-----LTKTEFENI 89

  Fly   101 ILSMLRMMGQMEFMFDKMAGALKDD-------------RVRDLYLN---------------RDNK 137
            |:..::....::          ||.             ...|::.|               ::::
Human    90 IMQQVKRWSDIQ----------KDSFWLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKLQESR 144

  Fly   138 FDLVLSGYFMNVYQLGFAKKVKAPVIVVATMPPNQLL----NPLIGNPLEIAYVP----SISDSV 194
            ||::.:..|....:| .|..:..|.:......|...:    ..||..|   :|:|    .:||. 
Human   145 FDIIFADAFFPCGEL-LAALLNIPFVYSLCFTPGYTIERHSGGLIFPP---SYIPVVMSKLSDQ- 204

  Fly   195 EKGKGMSFRQRLAGYSSSFFFGI-FDFVTQRRSKRLYKELFGDDPNMPEYSE-----LVKNTSLI 253
                 |:|.:|:.......:|.. |.....::..:.|.|:.|....:.|...     |::| |..
Human   205 -----MTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRN-SWS 263

  Fly   254 FFASHAPSEGPIRPNVPAAIEIGGIQVKDTPDPLPQNMAEFL-GNATDGAILLSLGSNVKGSHIN 317
            |...|     |..||:..   :||:..|.. .|||:.|.||: .:..:|.::.||||.:  |::.
Human   264 FQFPH-----PFLPNIDF---VGGLHCKPA-KPLPKEMEEFVQSSGENGVVVFSLGSVI--SNMT 317

  Fly   318 PDTVVKMFNVLSKLKQRVIWKWEDLEKTPGKSDNIFYSKWLPQDDILAHPNIKLFINHAGKGGIT 382
            .:....:...|:|:.|:|:|:: |..|......|....||:||:|:|..|..:.||.|.|..||.
Human   318 AERANVIATALAKIPQKVLWRF-DGNKPDALGLNTRLYKWIPQNDLLGLPKTRAFITHGGANGIY 381

  Fly   383 EAQYHGKPMLSLPVFGDQPGNADVMVKQGFGLTQSLLSLEEQPFKEAILEILSNPQYFDKVASFS 447
            ||.|||.||:.:|:|.|||.|...|..:|..:.....::.......|:..::::|.|.:.|...|
Human   382 EAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTMSSTDLLNALKTVINDPSYKENVMKLS 446

  Fly   448 SLYRDRPMSARESVIYWTEYVIRHHGAAHLQSPLVHMSFIAANNIDIYA-LIAVVLVILVLLLKL 511
            .:..|:|:......::|.|:|:.|.||.||:.....:::...:::|:.. |:|.|..::.::.|.
Human   447 IIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAARDLTWFQYHSLDVIGFLLACVATVIFVVTKF 511

  Fly   512 LLQFIYRKIFAKPKKEKK 529
            .| |.:.|...|.||.|:
Human   512 CL-FCFWKFARKGKKGKR 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 119/496 (24%)
UGT2B28NP_444267.1 UDPGT 24..525 CDD:278624 128/533 (24%)
egt <269..506 CDD:223071 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.