DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:89 Identity:23/89 - (25%)
Similarity:39/89 - (43%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RDNKFDLVLSGYFMNVYQLGF-AKKVKAPVIVVATMPPNQLLNPLIGNPLEIAYVPSISDSVEKG 197
            |...|||.::..|.......| |.|::|.|.|::....:. ::..||.|:..:|:|....:  .|
 Worm    37 RAENFDLAITEPFDTCANALFEAIKIRAHVAVLSCSRLDH-VSKAIGQPIAPSYLPGTQST--HG 98

  Fly   198 KGMSFRQRLAGYSSSFFFGIFDFV 221
            :.|:..||        |..|..|:
 Worm    99 ERMTIWQR--------FMNILHFL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 23/89 (26%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 23/89 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.