DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37A2 and ugt-63

DIOPT Version :9

Sequence 1:NP_650228.1 Gene:Ugt37A2 / 41573 FlyBaseID:FBgn0038082 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_504369.1 Gene:ugt-63 / 182223 WormBaseID:WBGene00015449 Length:506 Species:Caenorhabditis elegans


Alignment Length:240 Identity:61/240 - (25%)
Similarity:113/240 - (47%) Gaps:11/240 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 GIQVKDTPDPLPQNMAEFLGN-ATDGAILLSLGSNV---KGSHINPDTVVKMFNVLSKLKQRVIW 337
            |...|::..||......|:.: .:.|.||::.|:.:   |......|....:.|.||  :.|:||
 Worm   272 GAYCKESSKPLDLEFKTFIEHPKSKGTILIAFGTFIDWRKAPKNYYDAFATVVNRLS--EYRIIW 334

  Fly   338 KWEDLEKTPGKSDNIFYSKWLPQDDILAHPNIKLFINHAGKGGITEAQYHGKPMLSLPVFGDQPG 402
            ..:. |:.||...::..|.|:||:.||.|....||::|.|.....|......|.:.:|:||:|..
 Worm   335 SMKG-ERPPGLKKHVKTSSWVPQNQILHHNKTVLFLSHGGLKSTKEVICSATPTIFVPMFGEQTR 398

  Fly   403 NADVMVKQGFGLTQSLLSLEEQPFKEAILEILSNPQYFDKVASFSSLYRDRPMSARESVIYWTEY 467
            ||.::.::||....:...:........:.|:|.:|.|......|.:.|.|:|:...:...:....
 Worm   399 NAWLIKEKGFARIMNKFKINVDELDTHMREVLEHPNYQQNANKFLTYYMDQPIPTLDEGAFKFNR 463

  Fly   468 VIRHHG--AAHLQSPLVHMSFIAANNIDIYALIAVVLVILVLLLK 510
            ::::.|  .:|.....:.:|:....|:|:  ||.|.:::|.|:||
 Worm   464 LVKYGGKMPSHFYPKSLDLSYFTVLNVDL--LIVVPIMMLYLVLK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37A2NP_650228.1 egt 8..490 CDD:223071 52/218 (24%)
ugt-63NP_504369.1 Glycosyltransferase_GTB_type <276..500 CDD:299143 56/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.