DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and RDL1

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_014928.1 Gene:RDL1 / 854459 SGDID:S000005811 Length:139 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:37/105 - (35%)
Similarity:52/105 - (49%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEEVKDI--PNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPA 65
            ::|::|.|  .:.|...|.|||..||.....: |||||:|......|..|...:|.:..|..||.
Yeast    26 SFEDMKRIVGKHDPNVVLVDVREPSEYSIVHI-PASINVPYRSHPDAFALDPLEFEKQIGIPKPD 89

  Fly    66 VDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEW 105
            ....|||.|.:|.|...|..:||:.|::|...|.||..:|
Yeast    90 SAKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 37/105 (35%)
RDL1NP_014928.1 RHOD_HSP67B2 25..131 CDD:238777 37/105 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I2083
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1606
Isobase 1 0.950 - 0 Normalized mean entropy S2912
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - mtm9162
orthoMCL 1 0.900 - - OOG6_100801
Panther 1 1.100 - - O PTHR44086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 1 1.000 - - X3454
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.