DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and MST1

DIOPT Version :10

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_565203.1 Gene:MST1 / 844264 AraportID:AT1G79230 Length:379 Species:Arabidopsis thaliana


Alignment Length:115 Identity:32/115 - (27%)
Similarity:51/115 - (44%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEEVKDIPNHPEKYLFDVRNESELKET----------GVLPASINIPLSELEKALN--LPEEDF 55
            |.::||:....|.....|.|:::....|          |.:|.|..||..::..:.|  ||.|:.
plant   250 TLDQVKNNMEDPTYQHIDARSKARFDGTAPEPRKGIRSGHIPGSKCIPFPQMFDSCNTLLPAEEL 314

  Fly    56 AQTYGRVKPAVDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEW 105
            .:.:.:...::|..::.||..|..|...|.....||.|:...|.||||||
plant   315 KKRFDQEDISLDKPIMASCGTGVTACILAMGLHRLGKTDVPIYDGSWTEW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 32/115 (28%)
MST1NP_565203.1 PLN02723 58..377 CDD:178324 32/115 (28%)

Return to query results.
Submit another query.