DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and MST1

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_565203.1 Gene:MST1 / 844264 AraportID:AT1G79230 Length:379 Species:Arabidopsis thaliana


Alignment Length:115 Identity:32/115 - (27%)
Similarity:51/115 - (44%) Gaps:12/115 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEEVKDIPNHPEKYLFDVRNESELKET----------GVLPASINIPLSELEKALN--LPEEDF 55
            |.::||:....|.....|.|:::....|          |.:|.|..||..::..:.|  ||.|:.
plant   250 TLDQVKNNMEDPTYQHIDARSKARFDGTAPEPRKGIRSGHIPGSKCIPFPQMFDSCNTLLPAEEL 314

  Fly    56 AQTYGRVKPAVDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEW 105
            .:.:.:...::|..::.||..|..|...|.....||.|:...|.||||||
plant   315 KKRFDQEDISLDKPIMASCGTGVTACILAMGLHRLGKTDVPIYDGSWTEW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 32/115 (28%)
MST1NP_565203.1 PLN02723 58..377 CDD:178324 32/115 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I4683
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.