DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and STR16

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_851278.1 Gene:STR16 / 836734 AraportID:AT5G66040 Length:120 Species:Arabidopsis thaliana


Alignment Length:98 Identity:26/98 - (26%)
Similarity:42/98 - (42%) Gaps:19/98 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYLFDVRNESELKETGVLPASINIP--------LSELEKALNLPEEDFAQTYGRVKPAVDAVLIF 72
            :|| |||...|..: |....:||:|        :|:....|......|.|:        |.::: 
plant    25 RYL-DVRTPEEFSQ-GHACGAINVPYMNRGASGMSKNPDFLEQVSSHFGQS--------DNIIV- 78

  Fly    73 SCKAGGRAARAANLASTLGFTNAKAYAGSWTEW 105
            .|::|||:.:|.......|||..|...|.::.|
plant    79 GCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAW 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 26/98 (27%)
STR16NP_851278.1 RHOD 10..118 CDD:412175 26/98 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2670
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.730

Return to query results.
Submit another query.