DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and AT4G27700

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_567785.1 Gene:AT4G27700 / 828884 AraportID:AT4G27700 Length:224 Species:Arabidopsis thaliana


Alignment Length:121 Identity:30/121 - (24%)
Similarity:44/121 - (36%) Gaps:35/121 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LFDVRNESELKETGVLPASINIPLSEL-------EKALNL----------PEE--DFAQTYGRVK 63
            :.|||.|:|.| .|..|.:||:.:..|       :.|..|          .||  :|.|:. ..|
plant    93 ILDVRPEAEYK-AGHPPGAINVEMYRLIREWTAWDIARRLGFAFFGIFSGTEENPEFIQSV-EAK 155

  Fly    64 PAVDAVLIFSCKAGG--------------RAARAANLASTLGFTNAKAYAGSWTEW 105
            ...:|.:|.:|.:.|              |:..||.|....|:.|.....|....|
plant   156 LDKEAKIIVACSSAGTMKPTQNLPEGQQSRSLIAAYLLVLNGYKNVFHLEGGIYTW 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 30/121 (25%)
AT4G27700NP_567785.1 RHOD 81..211 CDD:238089 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.