DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and AT4G24750

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_194206.2 Gene:AT4G24750 / 828577 AraportID:AT4G24750 Length:292 Species:Arabidopsis thaliana


Alignment Length:109 Identity:26/109 - (23%)
Similarity:37/109 - (33%) Gaps:39/109 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KYLFDVRNESE-----LKETGVLPA---SINIPLSELEKA----------------------LNL 50
            |.|.|||..||     :|.:..:|.   ..|:....|.|.                      |:.
plant   105 KPLLDVRPSSERNKAWIKGSTWVPIFDNDDNLDAGTLSKKVTSFAMGGWWSGAPTLSFNRLFLSK 169

  Fly    51 PEEDFAQTYGRVKPAVDAVLIFSCKAGGRAARAANLASTLGFTN 94
            .||.|.:         |:.||.:|:.|.|:..|..|....|:.|
plant   170 VEEKFPK---------DSELIVACQKGLRSLAACELLYNAGYEN 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 26/109 (24%)
AT4G24750NP_194206.2 RHOD 107..213 CDD:238089 25/107 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.