DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and AT2G17850

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001324888.1 Gene:AT2G17850 / 816295 AraportID:AT2G17850 Length:188 Species:Arabidopsis thaliana


Alignment Length:40 Identity:12/40 - (30%)
Similarity:18/40 - (45%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEWQAKQ 109
            ||..||:|.|:..|.....:.||...:...|.:..|..|:
plant   134 LILGCKSGVRSLHATKFLVSSGFKTVRNMDGGYIAWVNKR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 11/36 (31%)
AT2G17850NP_001324888.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2670
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.