powered by:
Protein Alignment CG12279 and AT2G17850
DIOPT Version :9
Sequence 1: | NP_650227.1 |
Gene: | CG12279 / 41570 |
FlyBaseID: | FBgn0038080 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001324888.1 |
Gene: | AT2G17850 / 816295 |
AraportID: | AT2G17850 |
Length: | 188 |
Species: | Arabidopsis thaliana |
Alignment Length: | 40 |
Identity: | 12/40 - (30%) |
Similarity: | 18/40 - (45%) |
Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 LIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEWQAKQ 109
||..||:|.|:..|.....:.||...:...|.:..|..|:
plant 134 LILGCKSGVRSLHATKFLVSSGFKTVRNMDGGYIAWVNKR 173
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12279 | NP_650227.1 |
RHOD_HSP67B2 |
2..107 |
CDD:238777 |
11/36 (31%) |
AT2G17850 | NP_001324888.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0607 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
45 |
1.000 |
Inparanoid score |
I2670 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1478958at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100801 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.770 |
|
Return to query results.
Submit another query.