DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and Tstd3

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_084116.1 Gene:Tstd3 / 77032 MGIID:1924282 Length:157 Species:Mus musculus


Alignment Length:103 Identity:48/103 - (46%)
Similarity:66/103 - (64%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPAVD 67
            ||.|:|.:.|..:..|.||||..|:.|.|.:|.||||||.|:.:||.:...||.:.|.:|||:..
Mouse    43 TYRELKSLLNSKDIMLIDVRNTLEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPSKS 107

  Fly    68 AVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEW 105
            ..|:|||.||.|:.:|.:.|.:|||.:|:.|||.|.||
Mouse   108 DRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEW 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 48/103 (47%)
Tstd3NP_084116.1 RHOD_HSP67B2 42..147 CDD:238777 48/103 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837129
Domainoid 1 1.000 93 1.000 Domainoid score I7530
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123813
Inparanoid 1 1.050 97 1.000 Inparanoid score I5010
Isobase 1 0.950 - 0 Normalized mean entropy S2912
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - otm42406
orthoMCL 1 0.900 - - OOG6_100801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 1 1.000 - - X3454
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.640

Return to query results.
Submit another query.