DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and Tstd3

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_575783.3 Gene:Tstd3 / 500420 RGDID:1563572 Length:157 Species:Rattus norvegicus


Alignment Length:114 Identity:49/114 - (42%)
Similarity:70/114 - (61%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPAVD 67
            ||.|:|::.|..:..|.||||..|:.|.|.:|.|:||||.|:.:||.:...:|.:.||..||:..
  Rat    44 TYRELKNLLNSKDIMLIDVRNTWEILEHGKIPGSVNIPLDEVGEALQMNPREFKEKYGEEKPSKS 108

  Fly    68 AVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEW------QAKQS 110
            ..|:|||.||.|:.:|.:.|.:|||.:|:.|.|.||||      :.|||
  Rat   109 DRLVFSCLAGVRSKKAMDTAISLGFNSAQHYIGGWTEWVTYEISEKKQS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 46/109 (42%)
Tstd3XP_575783.3 RHOD_HSP67B2 43..148 CDD:238777 46/103 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340846
Domainoid 1 1.000 92 1.000 Domainoid score I7407
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123813
Inparanoid 1 1.050 97 1.000 Inparanoid score I4933
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - otm44470
orthoMCL 1 0.900 - - OOG6_100801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3454
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.660

Return to query results.
Submit another query.