DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and Tstd1

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001157997.1 Gene:Tstd1 / 226654 MGIID:3648482 Length:133 Species:Mus musculus


Alignment Length:108 Identity:44/108 - (40%)
Similarity:62/108 - (57%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPAV- 66
            ::.|::.:.......|||||:..| ...|.:|.::|||:||||.|||:....|...|...||.: 
Mouse    26 SFSELRSLVASGRARLFDVRSPEE-AAAGTIPGALNIPVSELEIALNMDPAAFQTLYCAEKPKLE 89

  Fly    67 DAVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEWQAKQ 109
            |..|||.|:.|.|..:|..||..||:|.|:.|||::.||..||
Mouse    90 DKNLIFFCQMGRRGLQATQLAQGLGYTGARNYAGAYKEWLEKQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 42/104 (40%)
Tstd1NP_001157997.1 RHOD_HSP67B2 25..130 CDD:238777 42/104 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56156
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.