DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and tstd3

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_002932188.1 Gene:tstd3 / 100486879 XenbaseID:XB-GENE-5793436 Length:166 Species:Xenopus tropicalis


Alignment Length:102 Identity:40/102 - (39%)
Similarity:58/102 - (56%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPAVDA 68
            |||:||:.......:.|||...|:||.||:..|::||:.:|..||.|....|.:.|....|...:
 Frog    55 YEELKDLLKEEGVVIIDVREPWEVKEYGVIKGSLSIPMGDLASALQLDPLTFEKKYQVKMPEKTS 119

  Fly    69 VLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEW 105
            .|||||.||.|:.:|.::|.:|||.....|||.:.:|
 Frog   120 TLIFSCLAGIRSKKAVDVAGSLGFKRVHHYAGGFEDW 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 40/102 (39%)
tstd3XP_002932188.1 RHOD 54..157 CDD:381815 40/102 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8377
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123813
Inparanoid 1 1.050 87 1.000 Inparanoid score I4987
OMA 1 1.010 - - QHG56156
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - otm47516
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3454
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.