DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and TSTD1

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001106678.1 Gene:TSTD1 / 100131187 HGNCID:35410 Length:115 Species:Homo sapiens


Alignment Length:94 Identity:41/94 - (43%)
Similarity:57/94 - (60%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPAV-DAVLIFSCKAGGRAA 81
            |||||:..| ...|.:|.::|||:||||.||.:....|...|...||.: |..|:|.|:.|.|..
Human    23 LFDVRSREE-AAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGL 86

  Fly    82 RAANLASTLGFTNAKAYAGSWTEWQAKQS 110
            :|..||.:||:|.|:.|||::.||..|:|
Human    87 QATQLARSLGYTGARNYAGAYREWLEKES 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 39/89 (44%)
TSTD1NP_001106678.1 RHOD 7..112 CDD:381815 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 75 1.000 Domainoid score I9063
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5249
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56156
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 1 1.000 - - otm40340
orthoMCL 1 0.900 - - OOG6_100801
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.