powered by:
Protein Alignment CG12279 and TSTD3
DIOPT Version :9
Sequence 1: | NP_650227.1 |
Gene: | CG12279 / 41570 |
FlyBaseID: | FBgn0038080 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001182060.1 |
Gene: | TSTD3 / 100130890 |
HGNCID: | 40910 |
Length: | 97 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 26/63 - (41%) |
Similarity: | 38/63 - (60%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 TYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVKPA 65
||:|:|::.|.....|.|||...|:.|...:|.|||:||.|:.:||.:...||.:.|..|||:
Human 31 TYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPS 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001321 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100801 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1076 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3454 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.840 |
|
Return to query results.
Submit another query.