DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12279 and si:ch211-161h7.8

DIOPT Version :9

Sequence 1:NP_650227.1 Gene:CG12279 / 41570 FlyBaseID:FBgn0038080 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_001340407.1 Gene:si:ch211-161h7.8 / 100000133 ZFINID:ZDB-GENE-091204-302 Length:157 Species:Danio rerio


Alignment Length:112 Identity:44/112 - (39%)
Similarity:69/112 - (61%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATYEEVKD-IPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNLPEEDFAQTYGRVK- 63
            :.|||::|. :.||..: ||||||..|. :.|.:|.|:|:||.|||.:|.||.|.|.:.: :|| 
Zfish    47 VVTYEQLKGMLANHSVQ-LFDVRNPDEF-QAGRIPDSVNVPLGELEVSLKLPAEKFEEQF-KVKA 108

  Fly    64 -PAVDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAGSWTEWQAKQ 109
             ...|..::|.|::|.|:..|...|..|||:.|:.|||.:.:|:.::
Zfish   109 PQKADDNIVFHCRSGKRSLTALETAHRLGFSKARHYAGGYIDWEERE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12279NP_650227.1 RHOD_HSP67B2 2..107 CDD:238777 44/107 (41%)
si:ch211-161h7.8XP_001340407.1 RHOD 48..151 CDD:294087 43/105 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8512
eggNOG 1 0.900 - - E1_COG0607
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478958at2759
OrthoFinder 1 1.000 - - FOG0001321
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100801
Panther 1 1.100 - - LDO PTHR44086
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.