DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Past1 and END3

DIOPT Version :10

Sequence 1:NP_731737.1 Gene:Past1 / 41569 FlyBaseID:FBgn0016693 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_014315.1 Gene:END3 / 855640 SGDID:S000005028 Length:349 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:34/86 - (39%)
Similarity:50/86 - (58%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 IFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLI------N 516
            ||:||.|::.|::.......|..|||.:|||:|||.|:|:|.|..||.:||.:.:.||      |
Yeast    15 IFSGLKPIENKVNHDQVLPILYNSKLDSSVLNKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKN 79

  Fly   517 VKLEGCELPTVLPEHLVPPSK 537
            :.    .:|..||:.|:|.||
Yeast    80 IS----SVPDELPDWLIPGSK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Past1NP_731737.1 EHD_N 27..59 CDD:465295
EHD 63..303 CDD:206740
DUF5600 291..397 CDD:465667
EH 446..538 CDD:197477 34/86 (40%)
END3NP_014315.1 EF-hand_4 1..104 CDD:289529 34/86 (40%)
EH 123..221 CDD:197477
End3 186..345 CDD:432765
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.