DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Past1 and IRS4

DIOPT Version :10

Sequence 1:NP_731737.1 Gene:Past1 / 41569 FlyBaseID:FBgn0016693 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_012944.3 Gene:IRS4 / 853889 SGDID:S000001727 Length:615 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:32/108 - (29%)
Similarity:49/108 - (45%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 EHEWICNKDK-----------PRTDGIFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSD 496
            |..|:.|:.:           ....|..|.| |.||.|.|...:....:|.||||:|::|:...|
Yeast   465 ESMWVSNRHRHLNLLSWWPSITGDSGAINTL-PEDGLILGIIVRDIWKRSNLPNSLLAEIYTKVD 528

  Fly   497 VDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKRY 539
            ...||.||...|.:.:.|::..|.|.:||.|:.:.:.....||
Yeast   529 TRKDGTLDRKSFIVGMWLVDQCLYGRKLPNVVEQCVWDSVDRY 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Past1NP_731737.1 EHD_N 27..59 CDD:465295
EHD 63..303 CDD:206740
DUF5600 291..397 CDD:465667
EH 446..538 CDD:197477 29/102 (28%)
IRS4NP_012944.3 EH <498..570 CDD:197477 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.