DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Past1 and EPS15L1

DIOPT Version :10

Sequence 1:NP_731737.1 Gene:Past1 / 41569 FlyBaseID:FBgn0016693 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001425153.1 Gene:EPS15L1 / 58513 HGNCID:24634 Length:926 Species:Homo sapiens


Alignment Length:97 Identity:47/97 - (48%)
Similarity:63/97 - (64%) Gaps:1/97 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 EHEWICN-KDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSD 506
            |..|... ::|.:.||||..|.|::|.:||...|..|:.||||..||.::|.|||:|.||.||.|
Human   118 EAHWAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLDRD 182

  Fly   507 EFALALHLINVKLEGCELPTVLPEHLVPPSKR 538
            |||:|:||:...||...:|:.||..|:|||||
Human   183 EFAVAMHLVYRALEKEPVPSALPPSLIPPSKR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Past1NP_731737.1 EHD_N 27..59 CDD:465295
EHD 63..303 CDD:206740
DUF5600 291..397 CDD:465667
EH 446..538 CDD:197477 44/92 (48%)
EPS15L1NP_001425153.1 Interaction with DAB2. /evidence=ECO:0000250 15..368 47/97 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..261
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.