DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Past1 and Reps

DIOPT Version :10

Sequence 1:NP_731737.1 Gene:Past1 / 41569 FlyBaseID:FBgn0016693 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_609487.2 Gene:Reps / 34542 FlyBaseID:FBgn0032341 Length:907 Species:Drosophila melanogaster


Alignment Length:68 Identity:28/68 - (41%)
Similarity:37/68 - (54%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 GKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEH 531
            |.:||..|:....||::|...|..||:|.||..||.|...||..|:||:.::.....|||.||..
  Fly   283 GLLSGQAARNFFEKSRIPVEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHC 347

  Fly   532 LVP 534
            |.|
  Fly   348 LHP 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Past1NP_731737.1 EHD_N 27..59 CDD:465295
EHD 63..303 CDD:206740
DUF5600 291..397 CDD:465667
EH 446..538 CDD:197477 28/68 (41%)
RepsNP_609487.2 EH 262..345 CDD:197477 24/61 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.