DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Past1 and end3

DIOPT Version :10

Sequence 1:NP_731737.1 Gene:Past1 / 41569 FlyBaseID:FBgn0016693 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_595720.1 Gene:end3 / 2539902 PomBaseID:SPBC11G11.02C Length:375 Species:Schizosaccharomyces pombe


Alignment Length:84 Identity:36/84 - (42%)
Similarity:50/84 - (59%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 IFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGC 522
            ||.||.|.:|.:||:.|...|..|||.:..|.|||.|:|:|.||..|.||||:|:.:....:.|.
pombe    12 IFRGLNPENGYLSGSKAAGVLRSSKLSSDKLEKIWDLADIDDDGMFDFDEFAIAMKITFDLINGV 76

  Fly   523 --ELPTVLPEHLVPPSKRY 539
              .:|..:||.||..||::
pombe    77 YKTVPDRVPEALVSTSKKH 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Past1NP_731737.1 EHD_N 27..59 CDD:465295
EHD 63..303 CDD:206740
DUF5600 291..397 CDD:465667
EH 446..538 CDD:197477 35/81 (43%)
end3NP_595720.1 EF-hand_4 1..101 CDD:289529 36/84 (43%)
EH 132..226 CDD:197477
End3 193..368 CDD:432765
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.