DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijC and NINJ2

DIOPT Version :10

Sequence 1:NP_001097762.1 Gene:NijC / 41568 FlyBaseID:FBgn0038079 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_057617.3 Gene:NINJ2 / 4815 HGNCID:7825 Length:142 Species:Homo sapiens


Alignment Length:105 Identity:44/105 - (41%)
Similarity:71/105 - (67%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MDANRYATKKTIAQGMLDIALLTANASQLKYILQVGEQHQFYKLMLILISLSIVMQLLVGILFVV 80
            ::.|.|||||::|:.|||:||..:||.:||.:|:.|....:|..::.|||||:::|:::|:|.||
Human    22 INLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSSHYYTTLVTLISLSLLLQVVIGVLLVV 86

  Fly    81 IGSLNINRQQDQTAAVILNDVILVVVFIISVVNVIISGFG 120
            |..||:|..:.|.....||:...::||...|:||.|:.||
Human    87 IARLNLNEVEKQWRLNQLNNAATILVFFTVVINVFITAFG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijCNP_001097762.1 Ninjurin 18..119 CDD:461482 42/100 (42%)
NINJ2NP_057617.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Ninjurin 24..125 CDD:461482 42/100 (42%)
Helix alpha1. /evidence=ECO:0000269|PubMed:39667936, ECO:0007744|PDB:8SZB 25..37 7/11 (64%)
Helix alpha2. /evidence=ECO:0000269|PubMed:39667936, ECO:0007744|PDB:8SZB 38..57 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.