DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NijC and NijB

DIOPT Version :10

Sequence 1:NP_001097762.1 Gene:NijC / 41568 FlyBaseID:FBgn0038079 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_649068.1 Gene:NijB / 40057 FlyBaseID:FBgn0036822 Length:181 Species:Drosophila melanogaster


Alignment Length:123 Identity:43/123 - (34%)
Similarity:77/123 - (62%) Gaps:11/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGLQRVNENEMKAMD----ANRYATKKTIAQGMLDIALLTANASQLKYILQVGEQHQFYKLMLIL 63
            |.||...::..|...    .|.||..|.:|:|::|||||:|||:||::::...::...|...:|:
  Fly    55 SELQESKKSNKKCSSDLSTENSYAANKNVAEGLMDIALLSANANQLRFLITYNDKASTYIYSMIM 119

  Fly    64 ISLSIVMQLLVGILFVVIGSLN--INRQQDQTAAVILNDVILVVVFIISVVNVIISGF 119
            :.||:|:||||||:.:....|.  .||..::|     ||::::.||:|:|:|::::.|
  Fly   120 VILSLVLQLLVGIMLIFKRRLKRFRNRSYERT-----NDLLVMGVFMITVINILLAAF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NijCNP_001097762.1 Ninjurin 18..119 CDD:461482 38/102 (37%)
NijBNP_649068.1 Ninjurin 75..172 CDD:461482 38/101 (38%)

Return to query results.
Submit another query.