DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and ACTRT3

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_115876.3 Gene:ACTRT3 / 84517 HGNCID:24022 Length:372 Species:Homo sapiens


Alignment Length:369 Identity:164/369 - (44%)
Similarity:230/369 - (62%) Gaps:6/369 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPK-HVRVMAGALEGDIFVGPKAEEHRGLLSIRYP 74
            |||||||||:||||.||...|:..:||.|||.| ..|...|.||  :.||.:|::.|..|.|.||
Human     7 PVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLE--LCVGDQAQDWRSSLFISYP 69

  Fly    75 MEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFV 139
            :|.|::|.|.|||.:|.:||. ..|.....|.|||:||..|||..||::..|.|||.:..||.::
Human    70 VERGLITSWEDMEIMWKHIYD-YNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYM 133

  Fly   140 SMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFN 204
            |:||||:|:|.|..||:||:||.|||.:|||:||:.:||.:.::|:||.|:|.||..|::..|..
Human   134 SIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIM 198

  Fly   205 FRSTAEFEIVRSIKEKVCYLATNPQKEETVETE--KFAYKLPDGKIFEIGPARFRAPEVLFRPDL 267
            ..|.::.:||..|||..||:|.|.::|...:.:  :..|:|||||:.::....|..||.||.|..
Human   199 LLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCLEKVYQLPDGKVIQLHDQLFSCPEALFSPCH 263

  Fly   268 LGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAA 332
            :..|..||..:...||.|.|..||...:.||:|:||||.|.|...||:.::.|.:..:..:::.|
Human   264 MNLEAPGIDKICFSSIMKCDTGLRNSFFSNIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIA 328

  Fly   333 PQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF 376
            |.||..|.||||||||||..|:.|||:..|::|.|...||::.|
Human   329 PPERKISVWMGGSILASLSAFQDMWITAAEFKEVGPNIVHQRCF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 163/367 (44%)
ACTIN 9..376 CDD:214592 163/367 (44%)
ACTRT3NP_115876.3 ACTIN 7..372 CDD:214592 163/367 (44%)
NBD_sugar-kinase_HSP70_actin 9..372 CDD:302596 161/365 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.