DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and AT2G42170

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001323727.1 Gene:AT2G42170 / 818817 AraportID:AT2G42170 Length:329 Species:Arabidopsis thaliana


Alignment Length:333 Identity:171/333 - (51%)
Similarity:235/333 - (70%) Gaps:8/333 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MAGALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTE 112
            |.|..|.|:|||..||...|:|::.||||||:|::|:|||:||.:.:..| |....|:|||||||
plant     1 MVGMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSE-LRVAPEEHPVLLTE 64

  Fly   113 APLNPRRNREKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMP 177
            |||||:.:|||..:..||....|::::.|||.|||:|:||.||.||||||||::.||||||.|:|
plant    65 APLNPKADREKMTQIMFETFAVPSMYIGMQAALSLHASGRTTGTVLDSGDGVSYIVPIYEGSALP 129

  Fly   178 HSIMRVDIAGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKEETVETEKFA-- 240
            |:|:|:|:|||.:|.||..::...|:   ::||.|:||.|||:..|:|.:.::|....|:..|  
plant   130 HAILRLDLAGRHLTNYLMKIMMERGY---TSAEREVVRDIKEQFGYIALDYEQEMEKATKSSAID 191

  Fly   241 --YKLPDGKIFEIGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGG 303
              |:||||::..||..|||.|||||:|.|:|.|..|||:....||.|.|.|:||.||.|||||||
plant   192 RTYELPDGQVITIGAERFRCPEVLFQPSLIGMETSGIHEKTYNSIMKCDDDIRKDLYGNIVLSGG 256

  Fly   304 STLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQ 368
            :|:|:|..:|:..|:...:|.:::|:|.||.||.||.|:||||||||.|:::|||:|.||||.|.
plant   257 TTMFRGIEERMTKEINALAAANMRIKIVAPPERKYSVWIGGSILASLSTYEQMWITKAEYEENGP 321

  Fly   369 KAVHRKTF 376
            ..||.|.|
plant   322 AIVHTKCF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 170/331 (51%)
ACTIN 9..376 CDD:214592 170/331 (51%)
AT2G42170NP_001323727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.