DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actrt3

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_083966.1 Gene:Actrt3 / 76652 MGIID:1923902 Length:369 Species:Mus musculus


Alignment Length:369 Identity:163/369 - (44%)
Similarity:230/369 - (62%) Gaps:9/369 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPK-HVRVMAGALEGDIFVGPKAEEHRGLLSIRYP 74
            |||||||||:||||.||...|:..:||.:||.| |.   |.:.: ::.||.:|:|.|..|||.||
Mouse     7 PVVIDNGSGMIKAGLAGTREPQFVYPNILGRSKGHT---ADSRQ-ELCVGDQAQERRSFLSISYP 67

  Fly    75 MEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFV 139
            :|.|:::.|.|||.:|.:||. ..|.....|.|||:||..|||..:|:..:|.|||.:..||.::
Mouse    68 VERGLISSWGDMEIMWKHIYD-YNLNLNASDGPVLVTEPALNPLADRQHISEVFFENLGVPAFYM 131

  Fly   140 SMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFN 204
            |.||||:|:|.|..||:||:||.|:|..|||:||:.:.|.:.::::||.|:|.||..|::.:|..
Mouse   132 SAQAVLALFAAGFTTGLVLNSGAGITQCVPIFEGYCLSHGVKQLNVAGSDLTSYLMMLLKGDGIM 196

  Fly   205 FRSTAEFEIVRSIKEKVCYLATNPQKEETVET--EKFAYKLPDGKIFEIGPARFRAPEVLFRPDL 267
            ...|.:.::|..|||..||:|.|.:.|.|.::  ||. |.|||||..::....|..||.||.|.|
Mouse   197 LLRTGDRKVVTDIKENACYVAMNYEDEMTKDSNLEKI-YTLPDGKTVKLHKQLFHCPEALFSPYL 260

  Fly   268 LGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAA 332
            :..:..||..:...||.|.|.|||...:.||:||||||.|.|...||:.::.|.:..:..:::.|
Mouse   261 VNVDAPGIDKMCFGSIMKCDTDLRNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPANTAVQVIA 325

  Fly   333 PQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF 376
            |.||..|.||||||||||..|:.|||:..|:||.|...||::.|
Mouse   326 PPERKISVWMGGSILASLSAFQDMWITAAEFEEVGPNIVHQRCF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 162/367 (44%)
ACTIN 9..376 CDD:214592 162/367 (44%)
Actrt3NP_083966.1 ACTIN 5..369 CDD:214592 162/367 (44%)
NBD_sugar-kinase_HSP70_actin 9..369 CDD:302596 160/365 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.