DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actl10

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001165111.1 Gene:Actl10 / 70362 MGIID:1917612 Length:346 Species:Mus musculus


Alignment Length:325 Identity:102/325 - (31%)
Similarity:179/325 - (55%) Gaps:20/325 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRN 120
            :..|....|..|.::..:|::||:|.||:.:|.:|..: ....|....|..|||::::|..|.:.
Mouse    20 VLPGAPGCELAGGVARAHPIKHGVVVDWDALEGLWERL-MVGGLQVHPEQWPVLVSDSPSAPPKG 83

  Fly   121 REKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDI 185
            |||.||..||.:..||..::..|:|:|.:.|..:|:.:::|.||.||.|||.|.:...:..|:::
Mouse    84 REKVAELLFEALTVPACHMANTALLALCSIGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNV 148

  Fly   186 AGRDVTRYLKTL-------IRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE--ETVETEKFAY 241
            ||..::||.:.|       ::.:|.: |.|     |..:|::.||::.:.|.:  :....::..:
Mouse   149 AGSTLSRYFRDLLVAACPDLQLQGLS-RKT-----VTQLKKRCCYVSLDFQGDICDPARHQRACF 207

  Fly   242 KLPDGKIFEIGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTL 306
            .|.:|....:|..|||.||.:|:|.|||....|:..:...:::|....||..|...:||:|||||
Mouse   208 CLGNGCYVRLGSERFRCPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTL 272

  Fly   307 FKGFGDRLLSEL----KKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWISKREYEEEG 367
            |.||.:|:..||    ::|....|:..:.|...|..:.|.|||::|||::|:..|:::..|:|.|
Mouse   273 FPGFVERMNLELEAQCRRHGYPALQPCLVAHPGRDTAVWTGGSMMASLNSFQCRWMTRAMYQEHG 337

  Fly   368  367
            Mouse   338  337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 102/325 (31%)
ACTIN 9..376 CDD:214592 102/325 (31%)
Actl10NP_001165111.1 NBD_sugar-kinase_HSP70_actin 37..341 CDD:302596 99/308 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.