DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actl9

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_899105.2 Gene:Actl9 / 69481 MGIID:1916731 Length:415 Species:Mus musculus


Alignment Length:368 Identity:138/368 - (37%)
Similarity:215/368 - (58%) Gaps:6/368 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPME 76
            ||||.|:|..|.||||:..|.......:|.....:......|.:.|:| :|...|..|.:..|:.
Mouse    51 VVIDMGTGTCKVGFAGQSQPTYTVATILGCQPKKQATKDQSELETFIG-EAARSRPELRLVKPIR 114

  Fly    77 HGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVSM 141
            :|||.||...|.||.:|. :..|...|.:||:|.::.|.:|..||||..|..||.:::|||:|:.
Mouse   115 NGIVVDWEAAELIWRHIL-EHDLQVATHEHPLLFSDPPFSPATNREKLVEVAFESLHSPALYVAS 178

  Fly   142 QAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFR 206
            |:|||:||.|||.|:|:|:|.||::.||:.:|:.:||:|.|:|:||..:|.:|..::...||:.:
Mouse   179 QSVLSVYAHGRVNGLVVDTGHGVSYTVPVVQGYNLPHAIQRLDLAGNHLTAFLAEMLLGSGFSLQ 243

  Fly   207 STAEFEIVRSIKEKVCYLATNPQKEETVETE--KFAYKLPDGKIFEIGPARFRAPEVLFR-PDLL 268
            . .:.::|.:||...||||.:.|||:....|  |.:.|||||:...:|...|:.||:||. |::.
Mouse   244 Q-EDLDLVENIKHHYCYLAPDFQKEQARPDEECKQSLKLPDGRTVTLGKELFQCPELLFHPPEIP 307

  Fly   269 GEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAP 333
            |....|:..:...|:.|...:||..:.:|::|.|||:||.|...|..:||....:.:..:.:.|.
Mouse   308 GLSPIGLPAMAEQSLLKVPQELRPHVARNVILCGGSSLFTGLEGRFRAELLHSLSPEDHVVVMAH 372

  Fly   334 QERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF 376
            ..|..|.|:||||||||..|:..|:.:.:|||.|.:.|:||.:
Mouse   373 PNRNLSVWIGGSILASLHAFQSCWVLREQYEERGPQVVYRKCY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 138/366 (38%)
ACTIN 9..376 CDD:214592 138/366 (38%)
Actl9NP_899105.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
ACTIN 48..414 CDD:214592 137/365 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.