DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and ACTR3C

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_016868037.1 Gene:ACTR3C / 653857 HGNCID:37282 Length:280 Species:Homo sapiens


Alignment Length:270 Identity:85/270 - (31%)
Similarity:126/270 - (46%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FEGINAPALFVSMQAVLSLYA--TGR------VTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDI 185
            ||..|.|.|::::||||:|.|  |.|      :||:|:||||||||.:|:.||:.:...|..:.|
Human     2 FESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPI 66

  Fly   186 AGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLA-----------TNPQK-------EE 232
            ||||:|.:::.|:|............|..::||||.||:.           .:|||       ..
Human    67 AGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGIN 131

  Fly   233 TVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLG-EECEGIHDVLMYSIEKSDMDLRKMLYQ 296
            .:..:||        :.::|..||..||:.|.|:... :..|.|.||:...|:...:|:|:.||:
Human   132 AINQKKF--------VIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYK 188

  Fly   297 NI-VLSG---------GSTLFKGFGDRLLSELKK--------HSAKDLK-IRIAAPQERLYSTWM 342
            .: ||.|         ||    |....||..|..        ..|::|. :||..|..|  |...
Human   189 VLGVLPGRYRDHPMRYGS----GSWQNLLCHLPTIPGRFGGWSPAQELSGLRILPPLHR--SLQR 247

  Fly   343 GGSILASLDT 352
            |||..|..|:
Human   248 GGSPRARPDS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 85/270 (31%)
ACTIN 9..376 CDD:214592 85/270 (31%)
ACTR3CXP_016868037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.