DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actr10

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_062759.2 Gene:Actr10 / 56444 MGIID:1891654 Length:417 Species:Mus musculus


Alignment Length:406 Identity:95/406 - (23%)
Similarity:170/406 - (41%) Gaps:87/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVIDNGSGVIKAGFAGEHIPKCRFPNYI---GRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRY 73
            ||||.|....|.|||||..|:|..|:.|   |..|.::|                          
Mouse    16 VVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMSKPIKV-------------------------- 54

  Fly    74 PMEHGIVTDWNDMERIWSYIYSKE--------QLATFTEDHPVLLTEAPLNPRRNREKAAEFFFE 130
             :::.|.|     |.::||:  ||        .|.....|..|::.|:.|.|...||......|:
Mouse    55 -VQYNINT-----EELYSYL--KEFIHILYFRHLLVNPRDRRVVVIESVLCPSHFRETLTRVLFK 111

  Fly   131 GINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLK 195
            ....|::.::...:::|...|..:.:|||.|...:..:|||||..:.:....:.:.|:.:.:.|:
Mouse   112 YFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPILNCWGALPLGGKALHKELE 176

  Fly   196 TLIRREGFNFRSTAEFE------------IVRSIKEKVCYLATNPQKEETVETEKF--------- 239
            |.:..:.......|:.:            ::..||.:.|:: ::.::...::..||         
Mouse   177 TQLLEQCTVDTGAAKGQSLPSVMGSVPEGVLEDIKVRTCFV-SDLKRGLQIQAAKFNIDGNNERP 240

  Fly   240 ------AYKLPDGKIFEI-GPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQN 297
                  .|.|...||..: |..|....|:||..|   .|.:.:..:::.|:.:..:|.||.|.:|
Mouse   241 TPPPNVDYPLDGEKILHVLGSIRDSVVEILFEQD---NEEKSVATLILDSLLQCPIDTRKQLAEN 302

  Fly   298 IVLSGGSTLFKGFGDRLLSELK--------KHSAKDLKIRIAAPQERLYS-TWMGGSILASL-DT 352
            :|:.||:::..||..|||:|::        |.:......||..|..:... .|:||::..:| |.
Mouse   303 LVIIGGTSMLPGFLHRLLAEIRYLVEKPKYKKTLGTKNFRIHTPPAKANCVAWLGGAVFGALQDI 367

  Fly   353 FKKMWISKREYEEEGQ 368
            .....|||..|.:.|:
Mouse   368 LGSRSISKEYYNQTGR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 95/406 (23%)
ACTIN 9..376 CDD:214592 95/406 (23%)
Actr10NP_062759.2 Actin 13..364 CDD:330363 88/385 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.