DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Arp53D

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_477037.2 Gene:Arp53D / 36879 FlyBaseID:FBgn0011743 Length:411 Species:Drosophila melanogaster


Alignment Length:365 Identity:189/365 - (51%)
Similarity:253/365 - (69%) Gaps:2/365 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPME 76
            |||||||||.||||:.|..|:..||:.:|||:|:.|:..::.||..:|..|...||:|:::||:|
  Fly    49 VVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIGEAAARKRGILTLKYPIE 113

  Fly    77 HGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVSM 141
            ||:|.:|::||.:|.:.|  |.|.....|.|.|||||||||::||||..|..||....||.:|::
  Fly   114 HGMVKNWDEMEMVWQHTY--ELLRADPMDLPALLTEAPLNPKKNREKMTEIMFEHFQVPAFYVAV 176

  Fly   142 QAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFR 206
            |||||||||||..|:|:||||||||.||||||||:||:.:|||:||||:|.||..|:...|....
  Fly   177 QAVLSLYATGRTVGIVVDSGDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMG 241

  Fly   207 STAEFEIVRSIKEKVCYLATNPQKEETVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEE 271
            ::||.||||.||||:||::.|..||..:..:...|:||||:...:|..|||.||.||:|.|||:|
  Fly   242 TSAEREIVREIKEKLCYVSMNYAKEMDLHGKVETYELPDGQKIVLGCERFRCPEALFQPSLLGQE 306

  Fly   272 CEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQER 336
            ..|||:...:||...||||||.:|.|||||||:|:|:....|.|.:|.:.:...::|::.|..:|
  Fly   307 VMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIEHRFLQDLTEMAPPSIRIKVNASPDR 371

  Fly   337 LYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF 376
            .:|.|.|||:||||.:|:.|||...||||.|...||||.|
  Fly   372 RFSVWTGGSVLASLTSFQNMWIDSLEYEEVGSAIVHRKCF 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 188/363 (52%)
ACTIN 9..376 CDD:214592 188/363 (52%)
Arp53DNP_477037.2 ACTIN 46..411 CDD:214592 188/363 (52%)
NBD_sugar-kinase_HSP70_actin 47..411 CDD:302596 188/363 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.