DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actr3b

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001178789.1 Gene:Actr3b / 362298 RGDID:1565759 Length:418 Species:Rattus norvegicus


Alignment Length:408 Identity:140/408 - (34%)
Similarity:210/408 - (51%) Gaps:61/408 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHV--------RVMAGALEGDIFVGPKAEEHRG 67
            |.|:|.|:|..|.|:||...|:...|:.|...:..        ||:.|..:.|.|:|.:|.: :.
  Rat     7 PCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID-KP 70

  Fly    68 LLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGI 132
            ..:.::|:.||||.||:.|||....:..| .|....|||..|:||.|||...|||..||..||..
  Rat    71 TYATKWPIRHGIVEDWDLMERFMEQVVFK-YLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

  Fly   133 NAPALFVSMQAVLSLYA--TGR------VTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRD 189
            |.|.|::::||||:|.|  |.|      :||:|:||||||||.:|:.||:.:...|..:.|||||
  Rat   135 NVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRD 199

  Fly   190 VTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKE------------------ETVET 236
            :|.:::.|:|............|..::||||.||:..:..||                  ..:..
  Rat   200 ITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQ 264

  Fly   237 EKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEE-CEGIHDVLMYSIEKSDMDLRKMLYQNIVL 300
            .||        |.::|..||..||:.|.|:....: .|.|.||:...|:...:|:|:.||:||||
  Rat   265 RKF--------IIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNIVL 321

  Fly   301 SGGSTLFKGFGDRLLSELK----------------KHSAKDLKIRIAAPQERLYSTWMGGSILAS 349
            |||||:|:.||.||..:||                :...|.:::::.....:.|:.|.|||:|||
  Rat   322 SGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIKPKPVEVQVITHHMQRYAVWFGGSMLAS 386

  Fly   350 LDTFKKMWISKREYEEEG 367
            ...|.::..:|::|||.|
  Rat   387 TPEFFQVCHTKKDYEEYG 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 140/408 (34%)
ACTIN 9..376 CDD:214592 140/408 (34%)
Actr3bNP_001178789.1 PTZ00280 2..417 CDD:240343 140/408 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.