DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Arp10

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:403 Identity:77/403 - (19%)
Similarity:148/403 - (36%) Gaps:85/403 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEPYDVVVNQ--PVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAE 63
            |..|:.|:.:  |:|:|.|:...|.|||.|..|:...|..:                        
  Fly     1 MPIYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV------------------------ 41

  Fly    64 EHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKE---QLATFTE------------DHPVLLTEA 113
                           ::|.....:|::.|...:|   ||..|.:            :...:|.|.
  Fly    42 ---------------VMTTTGIRKRLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVEN 91

  Fly   114 PLNPRRNREKAAEFFFEGIN-APALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMP 177
            .......||..|...|...: :..|||.:. :::|......|.:|:|.|...|..:|::.|..:.
  Fly    92 VFGSTVLRETLARVLFVHFDVSSVLFVPVH-LIALSTLAVPTALVVDVGYSETSVMPVFSGVQIM 155

  Fly   178 HSIMRVDIAGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLAT--------NPQKEETV 234
            .:.......|..:...:|..:...|.. .|.....::..||.:.|::.|        |..:.:..
  Fly   156 AAFKDQSYGGSAIHAEIKRQLVESGVK-ESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPT 219

  Fly   235 ETEKFAYKLPDG-KIFEI-GPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQN 297
            ......|.:.|. .:.:: |..|..|.|::|.   ...|.:.:..:::.||....:|:|:.|.::
  Fly   220 PAPDVDYIVSDNDAVIQVPGLLRESAYEIMFE---ASNERDSLPHLILRSILDCTLDVRRALVES 281

  Fly   298 IVLSGGSTLFKGFGDRLLSELKK------------HSAKDLKIRIAAPQERLYSTWMGGSILASL 350
            :.|.||.::.:|...||..||:.            |.....|...|..::. ::.|:||::..:.
  Fly   282 VFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQN-FTAWLGGALCGAT 345

  Fly   351 DTFKKMWISKREY 363
            |..:...:.|..|
  Fly   346 DLIQTRSLVKETY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 75/399 (19%)
ACTIN 9..376 CDD:214592 74/395 (19%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 70/373 (19%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 74/392 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.