DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actl7b

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001020588.1 Gene:Actl7b / 313183 RGDID:1305655 Length:417 Species:Rattus norvegicus


Alignment Length:367 Identity:141/367 - (38%)
Similarity:210/367 - (57%) Gaps:7/367 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVIDNGSGVIKAGFAGEHIPKCRFPNYIG-RPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPM 75
            :|||.||...|.|:|||..|.....:.:| |...:...||....:.:||.:.......|.:..|:
  Rat    53 LVIDLGSQYCKCGYAGEPRPTYFISSTVGKRSAEMAADAGDTFKETYVGHELLNMEASLKLVNPL 117

  Fly    76 EHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVS 140
            :||:|.||:.::.||.||: ...:....|:|.||:::.||:|..||||.||..||....||:.|:
  Rat   118 KHGVVVDWDCIQNIWEYIF-HTAMKILPEEHAVLVSDPPLSPTSNREKYAELMFETFGIPAMHVT 181

  Fly   141 MQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNF 205
            .||:||:|:.|:.:|:|::||.||:|.|||.||..:|....|||.||.|:|.||..|:...|..|
  Rat   182 SQALLSIYSYGKTSGLVVESGHGVSHVVPISEGDLLPGLPSRVDYAGCDLTNYLMQLLNEAGHKF 246

  Fly   206 RSTAEFEIVRSIKEKVCYLATNPQKEETVETEKF--AYKLPDGKIFEIGPARFRAPEVLFRPDLL 268
             |.....|:..||:|.||.|..|::|.::..::.  .|:|||||:..||..|||..|:||:|.|:
  Rat   247 -SDDHLHIIEHIKKKCCYAALLPEEEMSLGLDELHVDYELPDGKVITIGQERFRCSEMLFKPSLV 310

  Fly   269 GEECEGIHDVLMYSIEK-SDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAA 332
            |....|:.::....::: .....::.:..|::|.||.|:..||.:|...||......|.....||
  Rat   311 GSTQPGLPELTATCLDRCQGTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPTVAAA 375

  Fly   333 PQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRK 374
            | ||..|.|.||||||||..|:::|:||.|:||.|..|::.|
  Rat   376 P-ERKTSVWTGGSILASLQAFQQLWVSKEEFEERGCAAIYSK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 141/367 (38%)
ACTIN 9..376 CDD:214592 141/367 (38%)
Actl7bNP_001020588.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
ACTIN 51..417 CDD:214592 141/367 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.