DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Actrt1

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001013983.1 Gene:Actrt1 / 302796 RGDID:1359559 Length:376 Species:Rattus norvegicus


Alignment Length:369 Identity:152/369 - (41%)
Similarity:222/369 - (60%) Gaps:2/369 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NQPVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRY 73
            |..|:.|||||:.|.|.:||.:|:....:.:|.||.....|.:.....|||.:|:.....|.:.|
  Rat     9 NPAVIFDNGSGLCKVGISGEIVPRHVINSVVGHPKFNIPSARSNRKRYFVGEEAQCMYDGLYLHY 73

  Fly    74 PMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALF 138
            |:|.|:||.|:|||::|..::..| |.....:.||.:||..||||..|||..|..||..|.|||:
  Rat    74 PIERGLVTRWDDMEKLWKDLFEWE-LGVKPNEQPVFMTEPSLNPRETREKTTEIMFEKFNVPALY 137

  Fly   139 VSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGF 203
            :...||.:|.|:..:||:|||||||||..||||||:::|.:|.::.:||||:|.:|..|:..:|:
  Rat   138 LCNHAVGALCASACITGLVLDSGDGVTCTVPIYEGYSLPRAITKLYVAGRDITEHLTRLLLAKGY 202

  Fly   204 NFRSTAEFEIVRSIKEKVCYLA-TNPQKEETVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPDL 267
            .|.......:|..||||:|.:: .:...|:..:.....||||||...::.....:.|||||.|:.
  Rat   203 TFPCILNKAVVDDIKEKLCTVSWGSKDSEKCYQRSLSEYKLPDGNTIQMSDHLCQVPEVLFTPEH 267

  Fly   268 LGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAA 332
            ||....||..::..||.|.|.|:::.|:..||||||:|||.|..||||.||:..:.:...|:|.|
  Rat   268 LGIHDLGISKMVCNSIMKCDTDIQENLFAEIVLSGGTTLFPGLQDRLLKELEVLAFEGTPIKITA 332

  Fly   333 PQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF 376
            ..:|.||.|:|||::.||.|||:||::..:::|.|...|.||.|
  Rat   333 SPDRCYSAWIGGSVMTSLTTFKQMWVTAEDFKEYGAFVVQRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 151/367 (41%)
ACTIN 9..376 CDD:214592 151/367 (41%)
Actrt1NP_001013983.1 ACTIN 9..376 CDD:214592 151/367 (41%)
NBD_sugar-kinase_HSP70_actin 11..376 CDD:302596 150/365 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.