DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and ACTL9

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_848620.3 Gene:ACTL9 / 284382 HGNCID:28494 Length:416 Species:Homo sapiens


Alignment Length:398 Identity:141/398 - (35%)
Similarity:224/398 - (56%) Gaps:29/398 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PYDVVVNQP-------------------VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVM 48
            |...|||:|                   ||||.|:|..|.||||:..|.......:|........
Human    24 PSPNVVNKPLQRDSPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPAT 88

  Fly    49 AGALEGDIFVGPKAEEHRGL--LSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLT 111
            :|......|:|   |..|.|  |::..|:..|||.||:..|.||.::. :..|...|.|||:|.:
Human    89 SGQSGLQTFIG---EAARVLPELTLVQPLRSGIVVDWDAAELIWRHLL-EHDLRVATHDHPLLFS 149

  Fly   112 EAPLNPRRNREKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAM 176
            :.|.:|..||||..|..||.:.:||::|:.|:|||:||.|||:|:|:|:|.|||:.||:::|:.:
Human   150 DPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNL 214

  Fly   177 PHSIMRVDIAGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKEETVETEKF-- 239
            .|:..|:|:||.::|.:|..::.:.|... ...:.::|.:||...||:|::.|||:....:::  
Human   215 LHATERLDLAGNNLTAFLAEMLLQAGLPL-GQQDLDLVENIKHHYCYVASDFQKEQARPEQEYKR 278

  Fly   240 AYKLPDGKIFEIGPARFRAPEVLFR-PDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGG 303
            ..|||||:...:|...|:.||:||. |::.|....|:..:...|:.|..:::|..|.||::|.||
Human   279 TLKLPDGRTVTLGKELFQCPELLFNPPEVPGLSPVGLSTMAKQSLRKLSLEMRADLAQNVLLCGG 343

  Fly   304 STLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQ 368
            |:||.||..|..:||.:....:..:.:||...|.:|.|:||||||||..|:..|:.:.:|||:|.
Human   344 SSLFTGFEGRFRAELLRALPAETHVVVAAQPTRNFSVWIGGSILASLRAFQSCWVLREQYEEQGP 408

  Fly   369 KAVHRKTF 376
            ..|:||.:
Human   409 YIVYRKCY 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 140/394 (36%)
ACTIN 9..376 CDD:214592 138/390 (35%)
ACTL9NP_848620.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 5/9 (56%)
NBD_sugar-kinase_HSP70_actin 49..416 CDD:302596 136/371 (37%)
ACTIN 49..415 CDD:214592 135/370 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.