DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp1 and Acta1

DIOPT Version :9

Sequence 1:NP_524331.2 Gene:Arp1 / 41566 FlyBaseID:FBgn0011745 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001258970.1 Gene:Acta1 / 11459 MGIID:87902 Length:377 Species:Mus musculus


Alignment Length:370 Identity:199/370 - (53%)
Similarity:271/370 - (73%) Gaps:7/370 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPME 76
            :|.|||||::||||||:..|:..||:.:|||:|..||.|..:.|.:||.:|:..||:|:::||:|
Mouse    10 LVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIE 74

  Fly    77 HGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVSM 141
            |||:|:|:|||:||.:.:..| |....|:||.|||||||||:.||||..:..||..|.||::|::
Mouse    75 HGIITNWDDMEKIWHHTFYNE-LRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAI 138

  Fly   142 QAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFR 206
            ||||||||:||.||:||||||||||.||||||:|:||:|||:|:||||:|.||..::...|::|.
Mouse   139 QAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFV 203

  Fly   207 STAEFEIVRSIKEKVCYLATNPQKE-----ETVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPD 266
            :|||.||||.||||:||:|.:.:.|     .:...|| :|:||||::..||..|||.||.||:|.
Mouse   204 TTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK-SYELPDGQVITIGNERFRCPETLFQPS 267

  Fly   267 LLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIA 331
            .:|.|..|||:....||.|.|:|:||.||.|.|:|||:|::.|..||:..|:...:...:||:|.
Mouse   268 FIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKII 332

  Fly   332 APQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF 376
            ||.||.||.|:||||||||.||::|||:|:||:|.|...||||.|
Mouse   333 APPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp1NP_524331.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:302596 198/368 (54%)
ACTIN 9..376 CDD:214592 198/368 (54%)
Acta1NP_001258970.1 PTZ00281 4..377 CDD:173506 198/368 (54%)
Interaction with alpha-actinin. /evidence=ECO:0000250|UniProtKB:P68135 112..125 7/12 (58%)
Interaction with alpha-actinin. /evidence=ECO:0000250|UniProtKB:P68135 360..372 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.